Glutaredoxin 1 anticorps

N° du produit ABIN632220

Cet anticorps anti-Glutaredoxin 1 est un anticorps Lapin Polyclonal détectant Glutaredoxin 1 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour Glutaredoxin 1 anticorps (ABIN632220)

Antigène: Glutaredoxin 1 (GRX1)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Glutaredoxin 1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Glutaredoxin 1 anticorps

Purification: Affinity purified

Immunogène: GLRX antibody was raised using a synthetic peptide corresponding to a region with amino acids IKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GLRX Blocking Peptide, (ABIN939415), is also available for use as a blocking control in assays to test for specificity of this GLRX antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLRX antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Glutaredoxin 1

Antigène: Glutaredoxin 1 (GRX1)

Autre désignation: GLRX

Sujet: GLRX has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. It reduces low molecular weight disulfides and proteins.

Poids moléculaire: 12 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis